Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

CLCN3 Antikörper (C-Term, Intracellular)

Der Kaninchen Polyklonal anti-CLCN3 Antikörper wird verwendet zum Nachweis von CLCN3 in Proben von Ratte, Human und Maus. Er wurde validiert für WB, IHC, IF, IC und IP.
Produktnummer ABIN7884874
1.466,46 €
Zzgl. Versandkosten 20,00 € und MwSt
200 μL
Lieferung nach: Deutschland
Lieferung in 8 bis 9 Werktagen

Kurzübersicht für CLCN3 Antikörper (C-Term, Intracellular) (ABIN7884874)

Target

Alle CLCN3 Antikörper anzeigen
CLCN3 (Chloride Channel 3 (CLCN3))

Reaktivität

  • 54
  • 29
  • 22
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Ratte, Human, Maus

Wirt

  • 46
  • 19
Kaninchen

Klonalität

  • 46
  • 19
Polyklonal

Konjugat

  • 23
  • 4
  • 4
  • 4
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser CLCN3 Antikörper ist unkonjugiert

Applikation

  • 52
  • 29
  • 20
  • 20
  • 14
  • 13
  • 13
  • 11
  • 4
  • 3
  • 2
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunochromatography (IC), Immunoprecipitation (IP)

Güteklasse

Carrier-free, KO Validated
  • Bindungsspezifität

    • 17
    • 15
    • 13
    • 8
    • 7
    • 6
    • 5
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 592-661, C-Term, Intracellular

    Verwendungszweck

    A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel

    Homologie

    rat CLC-5 - 49,70 amino acid residues identicalRat CLC-4 - 46, human,70 amino acid residues identical,rabbit,guinea pig - 69,Mouse - identical, Xenopus laevis - 61

    Aufreinigung

    The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

    Immunogen

    GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3

    Isotyp

    IgG
  • Applikationshinweise

    WB: 1:200

    FC: The optimal concentration should be determined by the user

    ICC: The optimal concentration should be determined by the user

    IHC: The optimal concentration should be determined by the user

    IP: The optimal concentration should be determined by the user

    Kommentare

    Negative Control: (ABIN7235086)

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    0.2 mL double distilled water (DDW)

    Konzentration

    1 mg/mL

    Buffer

    PBS pH 7.4

    Konservierungsmittel

    Without preservative

    Lagerung

    -20 °C

    Informationen zur Lagerung

    The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
  • Target

    CLCN3 (Chloride Channel 3 (CLCN3))

    Andere Bezeichnung

    Chloride channel 3

    Hintergrund

    Synonyms: Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

    Description: CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1,2CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3,4

    Gen-ID

    84360

    UniProt

    P51792
Sie sind hier:
Chat with us!