SLC34A2 Antikörper

Produktnummer ABIN7882316

Der Kaninchen Polyklonal anti-SLC34A2 Antikörper (ABIN7882316) detektiert spezifisch SLC34A2 in WB, IF und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für SLC34A2 Antikörper (ABIN7882316)

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC34A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-SLC34A2 Antikörper

Verwendungszweck: SLC34A2 Antibody

Sequenz: QNWTMKNVTY KENIAKCQHI FVNFHLPDLA

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SLC34A2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SLC34A2

Target: SLC34A2 (Solute Carrier Family 34 (Sodium Phosphate), Member 2 (SLC34A2))

Andere Bezeichnung: SLC34A2

Hintergrund: Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH -sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH . Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.

UniProt: O95436