SARS-CoV-2 NSP13 Antikörper

Produktnummer ABIN7882198

Der Kaninchen Polyklonal anti-SARS-CoV-2 NSP13 Antikörper wird verwendet zum Nachweis von SARS-CoV-2 NSP13 in Proben von Human. Er wurde validiert für ELISA.

Kurzübersicht für SARS-CoV-2 NSP13 Antikörper (ABIN7882198)

Target: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SARS-CoV-2 NSP13 Antikörper ist unkonjugiert

Applikation: ELISA

Produktdetails anti-SARS-CoV-2 NSP13 Antikörper

Verwendungszweck: SARS-CoV-2 Helicase Antibody / NSP13

Aufreinigung: Affinity purified

Immunogen: Amino acids YDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEE
TFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNggggPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVA
ITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ were used as the immunogen for the SARS-CoV-2 Helicase antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SARS-CoV-2 Helicase antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the SARS-CoV-2 Helicase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SARS-CoV-2 NSP13

Target: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Andere Bezeichnung: SARS-CoV-2 Helicase

Substanzklasse: Viral Protein

Hintergrund: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

UniProt: P0DTD1