RHOB Antikörper

Produktnummer ABIN7882139

Der Kaninchen Polyklonal anti-RHOB Antikörper (ABIN7882139) detektiert spezifisch RHOB in WB, IF und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Affe.

Kurzübersicht für RHOB Antikörper (ABIN7882139)

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Reaktivität: Human, Maus, Ratte, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-RHOB Antikörper

Verwendungszweck: RHOB Antibody

Sequenz: NKKDLRSDEH VRTELARMKQ EPVRTDDGRA MAVRIQAYDY LE

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RHOB antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the RHOB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu RHOB

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Andere Bezeichnung: RHOB

Hintergrund: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.

UniProt: P62745