PRDM14 Antikörper

Produktnummer ABIN7882022

Der Kaninchen Polyklonal anti-PRDM14 Antikörper (ABIN7882022) detektiert spezifisch PRDM14 in WB, IF, IHC (p) und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PRDM14 Antikörper (ABIN7882022)

Target: PRDM14 (PR Domain Containing 14 (PRDM14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRDM14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-PRDM14 Antikörper

Verwendungszweck: PRDM14 Antibody

Sequenz: QNLAAYYTPF PSYGHYRNSL ATVEEDFQPF RQLEA

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the PRDM14 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PRDM14

Target: PRDM14 (PR Domain Containing 14 (PRDM14))

Andere Bezeichnung: PRDM14

Hintergrund: This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.

UniProt: Q9GZV8