TPR Antikörper

Produktnummer ABIN7881865

Der Kaninchen Polyklonal anti-TPR Antikörper wird verwendet zum Nachweis von TPR in Proben von Human, Maus und Ratte. Er wurde validiert für WB, IHC (p), IF und FACS.

Kurzübersicht für TPR Antikörper (ABIN7881865)

Target: TPR (Nucleoprotein TPR (TPR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Produktdetails anti-TPR Antikörper

Verwendungszweck: TPR Antibody / Translocated promoter region protein

Sequenz: AAVLQQVLER TELNKLPKSV QNKLEKFLAD QQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TPR antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the TPR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu TPR

Target: TPR (Nucleoprotein TPR (TPR))

Andere Bezeichnung: TPR

Hintergrund: The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.

UniProt: P12270