NFIB Antikörper

Produktnummer ABIN7881837

Dieser Maus Monoklonal Antikörper detektiert spezifisch NFIB in WB, IF und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für NFIB Antikörper (ABIN7881837)

Target: NFIB (Nuclear Factor I/B (NFIB))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NFIB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Klon: 4D6E4

Produktdetails anti-NFIB Antikörper

Verwendungszweck: Nuclear factor 1 B-type Antibody / NFIB

Sequenz: ELVRVS

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids ELVRVS RTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR from the human protein were used as the immunogen for the Nuclear factor 1 B-type antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Nuclear factor 1 B-type antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Nuclear factor 1 B-type antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu NFIB

Target: NFIB (Nuclear Factor I/B (NFIB))

Andere Bezeichnung: Nuclear factor 1 B-type

Hintergrund: Nuclear factor 1 B-type is a protein that in humans is encoded by the NFIB gene. The NFIB gene is a part of the NFI gene complex that includes three other genes (NFIA, NFIC and NFIX). The NFIB gene is a protein coding gene that also serves as a transcription factor. This gene is essential in embryonic development and it works together with its gene complex to initiate tissue differentiation in the fetus. Through knockout experiments, researchers found that mice without the NFIB gene have severely underdeveloped lungs. This mutation does not seem to cause spontaneous abortions because in utero the fetus does not use its lungs for respiration. However, this becomes lethal once the fetus is born and has to take its first breath. It is thought that NFIB plays a role in down regulating the transcription factors TGF-?1 and Shh in normal gestation because they remained high in knockout experiments. The absence of NFIB also leads to insufficient amounts of surfactant being produced which is one reason why the mice cannot breathe once it is born. The knockout experiments demonstrated that NFIB has a significant role in fore-brain development. NFIB is typically found in pontine nuclei of the CNS, the cerebral cortex and the white matter of the brain and without NFIB these areas are dramatically affected.

UniProt: O00712