NFIA Antikörper

Produktnummer ABIN7881836

Der Maus Monoklonal anti-NFIA Antikörper (Klon 16H11) (ABIN7881836) detektiert spezifisch NFIA in WB, IF, FACS und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für NFIA Antikörper (ABIN7881836)

Target: NFIA (Nuclear Factor I/A (NFIA))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NFIA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 16H11

Produktdetails anti-NFIA Antikörper

Verwendungszweck: NFIA Antibody

Sequenz: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Aufreinigung: Purified

Immunogen: Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the NFIA antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Andere Bezeichnung: NFIA

Hintergrund: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.

UniProt: Q12857