MYH10 Antikörper

Produktnummer ABIN7881741

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MYH10 in WB, IF, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MYH10 Antikörper (ABIN7881741)

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYH10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-MYH10 Antikörper

Verwendungszweck: MYH10 Antibody / non-muscle Myosin IIB

Sequenz: QRTGLEDPER YLFVDRAVIY NPATQADWTA KK

Aufreinigung: Affinity purified

Immunogen: Amino acids QRTGLEDPERYLFVDRAVIYNPATQADWTAKK from the human protein were used as the immunogen for the MYH10 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MYH10 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the MYH10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MYH10

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Andere Bezeichnung: MYH10

Hintergrund: This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin, it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: P35580