MYH6 Antikörper

Produktnummer ABIN7881735

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MYH6 in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Ratte, Human und Maus.

Kurzübersicht für MYH6 Antikörper (ABIN7881735)

Target: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYH6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-MYH6 Antikörper

Verwendungszweck: Myosin 6 Antibody / MyHC-alpha / MYH6

Sequenz: RTLEDQANEY RVKLEEAQRS LNDFTTQRAK LQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein were used as the immunogen for the Myosin 6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Myosin 6 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Myosin 6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MYH6

Target: MYH6 (Myosin Heavy Chain 6, Cardiac Muscle, alpha (MYH6))

Andere Bezeichnung: Myosin 6

Hintergrund: Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.

UniProt: P13533