MSI1 Antikörper

Produktnummer ABIN7881687

Dieser Maus Monoklonal Antikörper detektiert spezifisch MSI1 in WB, IF und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MSI1 Antikörper (ABIN7881687)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser MSI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 2B9

Produktdetails anti-MSI1 Antikörper

Verwendungszweck: Msi1 Antibody / Musashi 1

Sequenz: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Aufreinigung: Affinity purified

Immunogen: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Msi1 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Msi1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Msi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Andere Bezeichnung: Msi1

Hintergrund: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance