MSI1 Antikörper

Produktnummer ABIN7881686

Der Kaninchen Polyklonal anti-MSI1 Antikörper (ABIN7881686) detektiert spezifisch MSI1 in WB, ELISA und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MSI1 Antikörper (ABIN7881686)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Flow Cytometry (FACS)

Produktdetails anti-MSI1 Antikörper

Verwendungszweck: Musashi 1 Antibody / MSI1

Sequenz: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Aufreinigung: Affinity purified

Immunogen: Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Musashi 1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Musashi 1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Musashi 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Andere Bezeichnung: Musashi 1

Hintergrund: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance