METTL3 Antikörper

Produktnummer ABIN7881630

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch METTL3 in WB, IF, ELISA, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für METTL3 Antikörper (ABIN7881630)

Target: METTL3 (Methyltransferase Like 3 (METTL3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-METTL3 Antikörper

Verwendungszweck: METTL3 Antibody

Sequenz: HNVQPNWITL GNQLDGIHLL DPDVVARFKQ RYPDGIISKP KNL

Aufreinigung: Affinity purified

Immunogen: Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the METTL3 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the METTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu METTL3

Target: METTL3 (Methyltransferase Like 3 (METTL3))

Andere Bezeichnung: METTL3

Hintergrund: N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

UniProt: Q86U44