MLX Antikörper

Produktnummer ABIN7881563

Der Kaninchen Polyklonal anti-MLX Antikörper (ABIN7881563) detektiert spezifisch MLX in WB und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Affe.

Kurzübersicht für MLX Antikörper (ABIN7881563)

Target: MLX (MAX-Like Protein X (MLX))

Reaktivität: Human, Maus, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Produktdetails anti-MLX Antikörper

Verwendungszweck: MLX Antibody / Max-like protein X

Sequenz: FQELSACVFS WIEEHCKPQT LREIVIGVLH QLKNQLY

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein were used as the immunogen for the MLX antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MLX antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the MLX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MLX

Target: MLX (MAX-Like Protein X (MLX))

Andere Bezeichnung: MLX

Hintergrund: Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

UniProt: Q9UH92