HMGB3 Antikörper

Produktnummer ABIN7881048

Der Maus Monoklonal anti-HMGB3 Antikörper wird verwendet zum Nachweis von HMGB3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB, IF und FACS.

Kurzübersicht für HMGB3 Antikörper (ABIN7881048)

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser HMGB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Klon: 8H9

Produktdetails anti-HMGB3 Antikörper

Verwendungszweck: HMG4 Antibody / HMGB3

Sequenz: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Aufreinigung: Affinity purified

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMG4 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HMG4 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HMG4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Andere Bezeichnung: HMG4

Hintergrund: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347