HMGB3 Antikörper

Produktnummer ABIN7881047

Dieser Maus Monoklonal Antikörper detektiert spezifisch HMGB3 in WB, IHC (p), IF und FACS. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HMGB3 Antikörper (ABIN7881047)

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser HMGB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Klon: 7G13

Produktdetails anti-HMGB3 Antikörper

Verwendungszweck: HMGB3 Antibody / HMG4

Sequenz: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Aufreinigung: Affinity purified

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMGB3 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HMGB3 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HMGB3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Andere Bezeichnung: HMGB3

Hintergrund: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347