HECTD3 Antikörper

Produktnummer ABIN7880991

Der Kaninchen Polyklonal anti-HECTD3 Antikörper wird verwendet zum Nachweis von HECTD3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB, IHC (p) und FACS.

Kurzübersicht für HECTD3 Antikörper (ABIN7880991)

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HECTD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-HECTD3 Antikörper

Verwendungszweck: HECTD3 Antibody

Sequenz: HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HECTD3 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HECTD3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HECTD3

Target: HECTD3 (HECT Domain Containing 3 (HECTD3))

Andere Bezeichnung: HECTD3

Hintergrund: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.

UniProt: Q5T447