GAD65 Antikörper

Produktnummer ABIN7880883

Der Maus Monoklonal anti-GAD65 Antikörper wird verwendet zum Nachweis von GAD65 in Proben von Human, Ratte und Maus. Er wurde validiert für WB, FACS, IHC (p) und IF.

Kurzübersicht für GAD65 Antikörper (ABIN7880883)

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GAD65 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF)

Klon: 7G2

Produktdetails anti-GAD65 Antikörper

Verwendungszweck: GAD2 Antibody / GAD65

Sequenz: KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ

Aufreinigung: Affinity purified

Immunogen: Amino acids KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ from the human protein were used as the immunogen for the GAD2 antibody.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GAD2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the GAD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu GAD65

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Andere Bezeichnung: GAD2

Hintergrund: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

UniProt: Q05329