FH Antikörper

Produktnummer ABIN7880830

Der Maus Monoklonal anti-FH Antikörper (Klon 9D8) (ABIN7880830) detektiert spezifisch FH in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Affe.

Kurzübersicht für FH Antikörper (ABIN7880830)

Target: FH (Fumarate Hydratase (FH))

Reaktivität: Human, Maus, Ratte, Affe

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser FH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 9D8

Produktdetails anti-FH Antikörper

Verwendungszweck: FH Antibody / Fumarate hydratase

Sequenz: YDKAAKIAKT AHKNGSTLKE TAIELGYLTA EQFDEWVKPK DMLGPK

Aufreinigung: Protein G affinity

Immunogen: Amino acids YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK were used as the immunogen for the FH antibody.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FH antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the FH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu FH

Target: FH (Fumarate Hydratase (FH))

Andere Bezeichnung: FH

Hintergrund: Fumarase (or fumarate hydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.

UniProt: P07954