DHX15 Antikörper

Produktnummer ABIN7880608

Der Kaninchen Polyklonal anti-DHX15 Antikörper (ABIN7880608) detektiert spezifisch DHX15 in WB, IHC (p), IF und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für DHX15 Antikörper (ABIN7880608)

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Produktdetails anti-DHX15 Antikörper

Verwendungszweck: DHX15 Antibody / Prp43

Sequenz: DIKPEWLVKI APQYYDMSNF PQCEAKRQLD RIIAKLQSKE YSQY

Aufreinigung: Affinity purified

Immunogen: Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the DHX15 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the DHX15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu DHX15

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Andere Bezeichnung: DHX15

Hintergrund: Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

UniProt: O43143