Cyclin T1 Antikörper

Produktnummer ABIN7880530

Der Maus Monoklonal anti-Cyclin T1 Antikörper (Klon 3B7) (ABIN7880530) detektiert spezifisch Cyclin T1 in WB und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Affe.

Kurzübersicht für Cyclin T1 Antikörper (ABIN7880530)

Target: Cyclin T1 (CCNT1)

Reaktivität: Human, Affe

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Cyclin T1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Klon: 3B7

Produktdetails anti-Cyclin T1 Antikörper

Verwendungszweck: CCNT1 Antibody / Cyclin-T1

Sequenz: QKQNSKSVPS AKVSLKEYRA KHAEELQKRQ LENM

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein were used as the immunogen for the CCNT1 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CCNT1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CCNT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Cyclin T1

Target: Cyclin T1 (CCNT1)

Andere Bezeichnung: CCNT1

Hintergrund: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

UniProt: O60563