Cofilin 2 Antikörper

Produktnummer ABIN7880465

Dieser Maus Monoklonal Antikörper detektiert spezifisch Cofilin 2 in WB, IF, FACS, ICC und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für Cofilin 2 Antikörper (ABIN7880465)

Target: Cofilin 2 (CFL2)

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Cofilin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 8C13

Produktdetails anti-Cofilin 2 Antikörper

Verwendungszweck: Cofilin 2 Antibody / CFL2

Sequenz: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Aufreinigung: Affinity purified

Immunogen: Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL were used as the immunogen for the Cofilin 2 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Cofilin 2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Cofilin 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Cofilin 2

Target: Cofilin 2 (CFL2)

Andere Bezeichnung: Cofilin 2

Hintergrund: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

UniProt: Q9Y281

Pathways: Caspase Kaskade in der Apoptose