CHTOP Antikörper

Produktnummer ABIN7880415

Der Kaninchen Polyklonal anti-CHTOP Antikörper wird verwendet zum Nachweis von CHTOP in Proben von Human, Maus, Ratte und Affe. Er wurde validiert für WB, IHC (p) und FACS.

Kurzübersicht für CHTOP Antikörper (ABIN7880415)

Target: CHTOP (Chromatin Target of PRMT1 (CHTOP))

Reaktivität: Human, Maus, Ratte, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHTOP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Produktdetails anti-CHTOP Antikörper

Verwendungszweck: CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77

Sequenz: AAQSAPKVVL KSTTKMSLNE RFTNMLKNKQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ were used as the immunogen for the CHTOP antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CHTOP antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CHTOP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu CHTOP

Target: CHTOP (Chromatin Target of PRMT1 (CHTOP))

Andere Bezeichnung: CHTOP

Hintergrund: This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

UniProt: Q9Y3Y2