CCR10 Antikörper

Produktnummer ABIN7880397

Der Kaninchen Polyklonal anti-CCR10 Antikörper wird verwendet zum Nachweis von CCR10 in Proben von Human. Er wurde validiert für WB und IHC (p).

Kurzübersicht für CCR10 Antikörper (ABIN7880397)

Target: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCR10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-CCR10 Antikörper

Verwendungszweck: CCR10 Antibody

Sequenz: TEATEQVSWG HYSGDEEDAY SAEPLPELCY KADVQAFSRA FQ

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ from the human protein were used as the immunogen for the CCR10 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CCR10 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CCR10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu CCR10

Target: CCR10 (Chemokine (C-C Motif) Receptor 10 (CCR10))

Andere Bezeichnung: CCR10

Hintergrund: C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues, the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27, MIM 604833), CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation.

UniProt: P46092