AKR1D1 Antikörper

Produktnummer ABIN7879946

Dieser Maus Monoklonal Antikörper detektiert spezifisch AKR1D1 in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für AKR1D1 Antikörper (ABIN7879946)

Target: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser AKR1D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 6I4

Produktdetails anti-AKR1D1 Antikörper

Verwendungszweck: AKR1D1 Antibody

Sequenz: EEMKDIEALN KNVRFVELLM WRDHPEYPFH DEY

Aufreinigung: Affinity purified

Immunogen: Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AKR1D1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu AKR1D1

Target: AKR1D1 (Aldo-Keto Reductase Family 1, Member D1 (AKR1D1))

Andere Bezeichnung: AKR1D1

Hintergrund: Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

UniProt: P51857

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process