ALDH2 Antikörper

Produktnummer ABIN7879939

Der Maus Monoklonal anti-ALDH2 Antikörper (Klon 5G7) (ABIN7879939) detektiert spezifisch ALDH2 in WB, IF und FACS. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für ALDH2 Antikörper (ABIN7879939)

Target: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ALDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Klon: 5G7

Produktdetails anti-ALDH2 Antikörper

Verwendungszweck: ALDH2 Antibody

Sequenz: SAAATQAVPA PNQQPEVFCN QIFINNEWHD A

Aufreinigung: Affinity purified

Immunogen: Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.

Isotyp: IgG2a

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ALDH2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ALDH2

Target: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Andere Bezeichnung: ALDH2

Hintergrund: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

UniProt: P05091