PDIA3 Antikörper (C-Term)

Produktnummer ABIN7877463

Der Maus Monoklonal anti-PDIA3 Antikörper wird verwendet zum Nachweis von PDIA3 in Proben von Human. Er wurde validiert für WB, IHC (p) und FACS.

Kurzübersicht für PDIA3 Antikörper (C-Term) (ABIN7877463)

Target: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser PDIA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Klon: 7E5-

Produktdetails anti-PDIA3 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: ERp57 Antibody / PDIA3

Sequenz: RELSDFISYL QREATNPPVI QEEKPKKKKK AQEDL

Aufreinigung: Antigen affinity purified

Immunogen: C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ERp57 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ERp57 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu PDIA3

Target: PDIA3 (Protein Disulfide Isomerase Family A, Member 3 (PDIA3))

Andere Bezeichnung: ERp57

Hintergrund: PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

UniProt: P30101

Pathways: Maintenance of Protein Location, Protein targeting to Nucleus, Cell RedoxHomeostasis