POR Antikörper (C-Term)

Produktnummer ABIN7877442

Der Maus Monoklonal anti-POR Antikörper wird verwendet zum Nachweis von POR in Proben von Human. Er wurde validiert für WB, FACS und IHC (p).

Kurzübersicht für POR Antikörper (C-Term) (ABIN7877442)

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser POR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 7F5

Produktdetails anti-POR Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: Cytochrome P450 Reductase Antibody / POR / CYPOR

Sequenz: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Aufreinigung: Antigen affinity purified

Immunogen: C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu POR

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Andere Bezeichnung: Cytochrome P450 Reductase

Hintergrund: POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interaktom