HSPA9 Antikörper (C-Term)

Produktnummer ABIN7877395

Der Maus Monoklonal anti-HSPA9 Antikörper (Klon 4I9) (ABIN7877395) detektiert spezifisch HSPA9 in WB, IF, FACS und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für HSPA9 Antikörper (C-Term) (ABIN7877395)

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser HSPA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 4I9

Produktdetails anti-HSPA9 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: HSPA9 Antibody / GRP75

Sequenz: KLFEMAYKKM ASEREGSGSS GTGEQKEDQK EEKQ

Aufreinigung: Affinity purified

Immunogen: C-terminal region amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ from the human protein were used as the immunogen for the HSPA9 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HSPA9 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HSPA9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HSPA9

Target: HSPA9 (Heat Shock 70kDa Protein 9 (Mortalin) (HSPA9))

Andere Bezeichnung: HSPA9

Hintergrund: HSPA9 (heat shock 70 kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

UniProt: P38646