GDF9 Antikörper (C-Term)

Produktnummer ABIN7877391

Der Maus Monoklonal anti-GDF9 Antikörper wird verwendet zum Nachweis von GDF9 in Proben von Human. Er wurde validiert für WB, ELISA und IHC (p).

Kurzübersicht für GDF9 Antikörper (C-Term) (ABIN7877391)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GDF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: GDF9-4261

Produktdetails anti-GDF9 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: GDF9 Antibody

Sequenz: VPAKYSPLSV LTIEPDGSIA YKEYEDMIAT KC

Aufreinigung: Protein G affinity chromatography

Immunogen: Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GDF9 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.2 mg/mL

Buffer: 0.2 mg/mL in 1X PBS with 0.1 mg/mL BSA (US sourced) and 0.05 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).

Details zu GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Andere Bezeichnung: GDF9

Hintergrund: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

UniProt: O60383