GDF9 Antikörper (C-Term)

Produktnummer ABIN7877390

Dieser Maus Monoklonal Antikörper detektiert spezifisch GDF9 in WB, ELISA und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für GDF9 Antikörper (C-Term) (ABIN7877390)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GDF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Güteklasse: Carrier-free

Klon: GDF9-4261

Produktdetails anti-GDF9 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: GDF9 Antibody (azide and preservative free)

Sequenz: VPAKYSPLSV LTIEPDGSIA YKEYEDMIAT KC

Aufreinigung: Protein G affinity chromatography

Immunogen: Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GDF9 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: 1 mg/mL in 1X PBS, BSA free, sodium azide free

Konservierungsmittel: Azide free

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).

Details zu GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Andere Bezeichnung: GDF9

Hintergrund: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

UniProt: O60383