IKZF1 Antikörper (AA 428-459)

Produktnummer ABIN7874942

Dieser Maus Monoklonal Antikörper detektiert spezifisch IKZF1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für IKZF1 Antikörper (AA 428-459) (ABIN7874942)

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser IKZF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Klon: 5F12H7

Produktdetails anti-IKZF1 Antikörper

Bindungsspezifität: AA 428-459

Verwendungszweck: IKZF1 Antibody / IKAROS

Sequenz: LKEEHRAYDL LRAASENSQD ALRVVSTSGE QM

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 428-459 (LKEEHRAYDLLRAASENSQDALRVVSTSGEQM) from the human protein were used as the immunogen for the IKZF1 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IKZF1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the IKZF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu IKZF1

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Andere Bezeichnung: IKZF1

Hintergrund: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

UniProt: Q13422

Pathways: Production of Molecular Mediator of Immune Response