GDF9 Antikörper (C-Term)

Produktnummer ABIN7862890

Der Maus Monoklonal anti-GDF9 Antikörper (Klon GDF9-4261) (ABIN7862890) detektiert spezifisch GDF9 in WB, IHC und ELISA. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für GDF9 Antikörper (C-Term) (ABIN7862890)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GDF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), ELISA

Klon: GDF9-4261

Produktdetails anti-GDF9 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: GDF9 (Growth Differentiation Factor 9) Antibody

Spezifität: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Aufreinigung: 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G.

Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 200 μg/mL

Buffer: Prepared in 10 mM PBS with 0.05 % BSA & 0.05 % azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Informationen zur Lagerung: Antibody with azide - store at 2 to 8 °C. Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Haltbarkeit: 24 months

Details zu GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Andere Bezeichnung: GDF9

Hintergrund:

Growth/differentiation factor 9, GDF-9, GDF9

Human ovary.

Molekulargewicht: 51kDa

Gen-ID: 2661, 25022

UniProt: O60383