SVOP Antikörper (Cytosolic, N-Term)

Produktnummer ABIN7823798

Der Maus Monoklonal Anti-SVOP Antikörper wurde für WB, ELISA und ICC validiert. Er ist geeignet, SVOP in Proben von Ratte zu detektieren.

Kurzübersicht für SVOP Antikörper (Cytosolic, N-Term) (ABIN7823798)

Target: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Reaktivität: Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser SVOP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Immunocytochemistry (ICC)

Güteklasse: Carrier-free

Klon: N356-23

Produktdetails anti-SVOP Antikörper

Bindungsspezifität: AA 1-85, Cytosolic, N-Term

Verwendungszweck: Anti-SVOP Antibody (BSA and Azide free)

Sequenz: MEEDLFQLRQ LPVVKFRRTG ESARSEDDAA SGEHDVQIEG VRVGLEAVEL DDGAAVPKEF ANPTDDTFMV EDAVEAIGFG RFQWK

Spezifität: No off-targets reported for SVOPL/SVOP2

Kreuzreaktivität: Maus

Produktmerkmale: Our Anti-SVOP mouse monoclonal primary antibody is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Aufreinigung: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.

Reinheit: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: PBS7.4, carrier free

Konservierungsmittel: Azide free

Handhabung: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Haltbarkeit: 12 months

Details zu SVOP

Target: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Andere Bezeichnung: SVOP

Hintergrund:

Synonyms: Synaptic vesicle 2-related protein (SV2-related protein)

Description Logic: Our Anti-SVOP mouse monoclonal primary antibody is produced from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Gene Name Alternatives: Svop

Molekulargewicht: 60 kDa

UniProt: Q9Z2I7