Ataxin 1 Antikörper (AA 164-197) (FL550)

Produktnummer ABIN7595561

Dieser Maus Monoklonal Antikörper erkennt spezifisch Ataxin 1 in IHC und ICC. Er zeigt eine Reaktivität gegenüber Maus.

Kurzübersicht für Ataxin 1 Antikörper (AA 164-197) (FL550) (ABIN7595561)

Target: Ataxin 1 (ATXN1)

Reaktivität: Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Ataxin 1 Antikörper ist konjugiert mit FL550

Applikation: Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Güteklasse: KO Validated

Klon: N76-3

Produktdetails anti-Ataxin 1 Antikörper (FL550)

Bindungsspezifität: AA 164-197

Verwendungszweck: Anti-Ataxin-1, 11NQ Antibody FL550 Conjugate

Sequenz: ATTPSQRSQL EAYSTLLANM GSLSQAPGHK VEPP

Spezifität: No off-targets reported

Kreuzreaktivität: Drosophila melanogaster, Human, Ratte

Produktmerkmale: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced in-house from hybridoma clone N76/3. It is KO validated, detects drosophila, human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Aufreinigung: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Reinheit: Purified mAbs are >90 % specific antibody.

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: PBS with 0.09 % azide7.4

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Haltbarkeit: 12 months

Details zu Ataxin 1

Target: Ataxin 1 (ATXN1)

Andere Bezeichnung: Ataxin-1

Hintergrund:

Synonyms: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Description Logic: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced from hybridoma clone N76/3. It is KO validated, detects drosophila, human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Gene Name Alternatives: Atxn1 Sca1

Molekulargewicht: 85 kDa

UniProt: P54254

Pathways: Synaptic Membrane