Aquaporin 4 Antikörper (Intracellular)

Produktnummer ABIN7581825

Dieses Anti-Aquaporin 4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Aquaporin 4 in WB, IHC, IF, FACS und IC. Geeignet für Ratte.

Kurzübersicht für Aquaporin 4 Antikörper (Intracellular) (ABIN7581825)

Target: Aquaporin 4 (AQP4)

Reaktivität: Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aquaporin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Flow Cytometry (FACS), Immunochromatography (IC)

Güteklasse: KO Validated

Produktdetails anti-Aquaporin 4 Antikörper

Bindungsspezifität: AA 249-323, Intracellular

Verwendungszweck: A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

Sequenz: GST fusion protein with the sequence EYVFCPDVEL KRRLKEAFSK AAQQTKGSYM EVEDNRSQVE TEDLILKPGV VHVIDIDRGD EKKGKDSSGE VLSSV

Spezifität: Intracellular, C-terminus

Homologie: Mouse - 73,75 amino acid residues identical, human - 69, bovine - 71, rabbit - 64

Produktmerkmale: Highly specific antibody directed against an epitope located at the intracellular C-terminal domain of rat AQP4. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (ABIN7581825) can be used in western blot, immunocytochemical, immunohistochemical and indirect flow cytometry applications. It recognizes the Aquaporin 4 channel from rat, mouse and human samples.

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:1000

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 0.2 mL double distilled water (DDW).

Konzentration: 1 mg/mL

Buffer: PBS pH 7.4

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Details zu Aquaporin 4

Target: Aquaporin 4 (AQP4)

Andere Bezeichnung: AQP4

Hintergrund: WCH4, Mercurial-insensitive water channel,Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

Gen-ID: 25293

UniProt: P47863

Pathways: Sensory Perception of Sound