CD4 Antikörper (AA 412-458)

Produktnummer ABIN7538099

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CD4 in WB und ELISA. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CD4 Antikörper (AA 412-458) (ABIN7538099)

Target: CD4

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA

Produktdetails anti-CD4 Antikörper

Bindungsspezifität: AA 412-458

Verwendungszweck: Rabbit polyclonal antibodies to CD4

Spezifität: CD4 full length protein

Kreuzreaktivität (Details): May cross-react with other species

Aufreinigung: Immunogen affinity column

Immunogen: IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI - alphaalpha 412-458

Isotyp: IgG, IgM

Anwendungsinformationen

Applikationshinweise: Western blot: 0.1-1.0 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: Glycine pH 7.2

Lagerung: 4 °C,-80 °C

Informationen zur Lagerung: Short term up to 1 month at 2-8°C, long term can be held for up to five years at -70°C

Details zu CD4

Target: CD4

Andere Bezeichnung: CD4

Hintergrund: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages

Molekulargewicht: 51111 Da

Gen-ID: 920

NCBI Accession: NP_000607

UniProt: P01730

Pathways: T-Zell Rezeptor Signalweg, Maintenance of Protein Location, CXCR4-mediated Signaling Events