GDF9 Antikörper (C-Term)

Produktnummer ABIN7126467

Der Maus Monoklonal Anti-GDF9-Antikörper wurde für WB, ELISA, Coat und IHC (f) validiert. Er ist geeignet, GDF9 in Proben von Human zu detektieren.

Kurzübersicht für GDF9 Antikörper (C-Term) (ABIN7126467)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser GDF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA, Coating (Coat), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))

Produktdetails anti-GDF9 Antikörper

Bindungsspezifität: C-Term

Spezifität: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Kreuzreaktivität (Details): Human.

Aufreinigung: 1.0mg/ml of Ab purified from Bioreactor by Protein A/G.

Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Known_Application: ELISA (For coating, order antibody without BSA), Western Blot (1-2 μg/mL), ,Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT),(Staining of formalin-fixed tissues requires heating tissue sections in 10 mM Tris with 1 mM EDTA, pH 9.0, for 45 min at 95 °C followed by cooling at RT for 20 minutes),Optimal dilution for a specific application should be determined.

Positive_Control: Human ovary.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 1.0 mg/mL

Buffer: Prepared in 10 mM PBS, WITHOUT BSA and Azide.

Konservierungsmittel: Azide free

Lagerung: -20 °C,-80 °C

Informationen zur Lagerung: Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous.

Haltbarkeit: 24 months

Details zu GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Andere Bezeichnung: GDF9

Hintergrund: Growth/differentiation factor 9, GDF-9, GDF9,GDF9 (Growth Differentiation Factor 9)
Cellular localisation: Cytoplasmic (secreted)

Molekulargewicht: 51kDa

Gen-ID: 2661, 25022

UniProt: O60383