DLG2 Antikörper (AA 336-379)
-
- Target Alle DLG2 Antikörper anzeigen
- DLG2 (Discs, Large Homolog 2 (DLG2))
-
Bindungsspezifität
- AA 336-379
-
Reaktivität
- Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (IF), Immunocytochemistry (ICC)
- Produktmerkmale
- Anti-PSD-93 Antibody (ABIN7043102, ABIN7045142 and ABIN7045143)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize PSD-93 from rat, mouse, and human samples.
- Aufreinigung
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110
- Isotyp
- IgG
- Top Product
- Discover our top product DLG2 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Konzentration
- 1 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- RT,4 °C,-20 °C
- Informationen zur Lagerung
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- DLG2 (Discs, Large Homolog 2 (DLG2))
- Andere Bezeichnung
- PSD-93 (DLG2 Produkte)
- Synonyme
- PPP1R58 antikoerper, PSD-93 antikoerper, PSD93 antikoerper, chapsyn-110 antikoerper, A330103J02Rik antikoerper, B230218P12Rik antikoerper, B330007M19Rik antikoerper, Dlgh2 antikoerper, Gm1197 antikoerper, discs, large homolog 2 (Drosophila) antikoerper, discs large MAGUK scaffold protein 2 antikoerper, dlg2 antikoerper, DLG2 antikoerper, Dlg2 antikoerper
- Hintergrund
- Alternative names: PSD-93, Discs large homolog 2, Dlg2, Chapsyn-110
- Gen-ID
- 64053
- NCBI Accession
- NM_001364
- UniProt
- Q63622
-