DLG2 Antikörper (AA 336-379)

Produktnummer ABIN7043102

Der Kaninchen Polyklonal Anti-DLG2-Antikörper wurde für WB, IHC, IP, IF und IC validiert. Er ist geeignet, DLG2 in Proben von Ratte zu detektieren.

Kurzübersicht für DLG2 Antikörper (AA 336-379) (ABIN7043102)

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Reaktivität: Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (IF), Immunochromatography (IC)

Güteklasse: KO Validated

Produktdetails anti-DLG2 Antikörper

Bindungsspezifität: AA 336-379

Verwendungszweck: A Rabbit Polyclonal Antibody to PSD-93

Spezifität: Between PDZ2 and PDZ3 domains.

Kreuzreaktivität: Maus, Ratte

Homologie: Human - 42,44 amino acid residues identical

Produktmerkmale: Anti- Antibody (ABIN7043102, ABIN7045142 and ABIN7045143) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize from rat, mouse, and human samples.

Aufreinigung: Affinity purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:1000

Kommentare:

Negative Control: (ABIN7235223)

Blocking Peptide: (ABIN7235223)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 0.2 mL double distilled water (DDW).

Konzentration: 1 mg/mL

Buffer: PBS pH 7.4

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Details zu DLG2

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Andere Bezeichnung: DLG2

Hintergrund: Discs large homolog 2, Dlg2, Chapsyn-110,Chapsyn 110 (also known as PSD-93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2.

Alternative names: PSD-93, Discs large homolog 2, Dlg2, Chapsyn-110

Gen-ID: 64053

NCBI Accession: NM_001364

UniProt: Q63622