CLCN3 Antikörper (C-Term, Intracellular)

Produktnummer ABIN7043052

Produktdetails anti-CLCN3 Antikörper

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Bindungsspezifität: AA 592-661, C-Term, Intracellular

Reaktivität: Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunoprecipitation (IP)

Produktmerkmale: Anti-CLC-3 (CLCN3) Antibody (ABIN7043052, ABIN7044121 and ABIN7044122)) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPR, corresponding to amino acid residues 592-661 of rat CLC-3

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Konzentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: RT,4 °C,-20 °C

Informationen zur Lagerung:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Details zu CLCN3

Target: CLCN3 (Chloride Channel 3 (CLCN3))

Andere Bezeichnung: CLC-3 (CLCN3) (CLCN3 Produkte)

Synonyme: CLC3 antikoerper, ClC-3 antikoerper, Clc3 antikoerper, CLCN3 antikoerper, fb78c02 antikoerper, wu:fb78c02 antikoerper, clc3 antikoerper, clc-3 antikoerper, chloride voltage-gated channel 3 antikoerper, chloride channel, voltage-sensitive 3 antikoerper, chloride channel 3 antikoerper, chloride channel protein 3 antikoerper, chloride channel, voltage-sensitive 3 S homeolog antikoerper, CLCN3 antikoerper, Clcn3 antikoerper, clcn3 antikoerper, PTRG_03131 antikoerper, BDBG_05668 antikoerper, MCYG_04420 antikoerper, clcn3.S antikoerper

Hintergrund: Alternative names: CLC-3 (CLCN3), Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Gen-ID: 84360

NCBI Accession: NM_001243372

UniProt: P51792