CD68 Antikörper (AA 27-282)

Produktnummer ABIN7442816

Dieses Anti-CD68-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CD68 in IHC, WB, IP und ICC. Geeignet für Maus.

Kurzübersicht für CD68 Antikörper (AA 27-282) (ABIN7442816)

Target: CD68 (CD68 Molecule (CD68))

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CD68 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Produktdetails anti-CD68 Antikörper

Bindungsspezifität: AA 27-282

Verwendungszweck: Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)

Spezifität: The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.

Aufreinigung: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogen: Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blotting: 0.01-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Kommentare:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 0.5 mg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Haltbarkeit: 24 months

Details zu CD68

Target: CD68 (CD68 Molecule (CD68))

Andere Bezeichnung: SCARD1

Hintergrund: CD68, GP110, Macrosialin, Macrophage Antigen CD68

UniProt: P31996