ENO2/NSE Antikörper (AA 2-285)

Produktnummer ABIN7427918

Dieses Anti-ENO2/NSE-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von ENO2/NSE in WB, IHC, IP und ICC. Geeignet für Human.

Kurzübersicht für ENO2/NSE Antikörper (AA 2-285) (ABIN7427918)

Target: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ENO2/NSE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Klon: C10

Produktdetails anti-ENO2/NSE Antikörper

Bindungsspezifität: AA 2-285

Verwendungszweck: Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Spezifität: The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.

Kreuzreaktivität: Maus, Ratte

Aufreinigung: Protein A + Protein G affinity chromatography

Immunogen: Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag

Isotyp: IgG2b kappa

Anwendungsinformationen

Applikationshinweise: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Kommentare:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Haltbarkeit: 24 months

Details zu ENO2/NSE

Target: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Andere Bezeichnung: Enolase, Neuron Specific

Hintergrund: ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase

UniProt: P09104