PTH Antikörper (AA 1-38)

Produktnummer ABIN6757890

Dieses Anti-PTH-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von PTH in IHC, ELISA, IHC (p), RIA und IHC (fro). Geeignet für Human und Affe.

Kurzübersicht für PTH Antikörper (AA 1-38) (ABIN6757890)

Target: PTH (Parathyroid Hormone (PTH))

Reaktivität: Human, Affe

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser PTH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Klon: A1-64

Produktdetails anti-PTH Antikörper

Bindungsspezifität: AA 1-38

Spezifität: Human Parathyroid Hormone (aa 1-38)Human PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1-86).

Homologie: Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%) Horse (97%) Elephant, Panda, Dog, Pig (94%) Bovine (90%) Hamster, Cat (87%) Rat (84%) Mouse (81%).

Aufreinigung: Protein G purified

Immunogen: Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%), Horse (97%), Elephant, Panda, Dog, Pig (94%), Bovine (90%), Hamster, Cat (87%), Rat (84%), Mouse (81%).

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1 μg/mL), IHC, IHC-Fr, IHC-P, RIA

Usage: Suitable for use in ELISA: 1 μg/mL. RIA: 25 ng/mL. Immunohistochemistry: 2 μg/mL. Frozen, paraffin.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from in 50 mM Tris,  pH 7.2, 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: May be stored at 4°C for short-term only. For long-term storage and to avoid freeze-thaw cycles, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 1 year at -20°C.

Details zu PTH

Target: PTH (Parathyroid Hormone (PTH))

Andere Bezeichnung: Parathyroid Hormone / PTH

Substanzklasse: Hormone

Hintergrund: Name/Gene ID: PTH
Family: Hormone

Synonyms: PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1

Gen-ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process