NPPB Antikörper (AA 1-32)

Produktnummer ABIN6757749

Dieses Anti-NPPB-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von NPPB in ELISA. Geeignet für Human.

Kurzübersicht für NPPB Antikörper (AA 1-32) (ABIN6757749)

Target: NPPB (Natriuretic Peptide Precursor B (NPPB))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NPPB Antikörper ist unkonjugiert

Applikation: ELISA

Klon: 21-Mar

Produktdetails anti-NPPB Antikörper

Bindungsspezifität: AA 1-32

Spezifität: Recognizes synthetic human Brain Natriuretic Peptide (aa 1-32).

Homologie: Percent identity by BLAST analysis: Human, Gibbon (100%).

Aufreinigung: Protein G purified

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH). Percent identity by BLAST analysis: Human, Gibbon (100%).

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Approved: ELISA

Usage: Suitable for use in ELISA.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from PBS,  pH 7.2

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.

Details zu NPPB

Target: NPPB (Natriuretic Peptide Precursor B (NPPB))

Andere Bezeichnung: NPPB / BNP

Hintergrund: Name/Gene ID: NPPB

Synonyms: NPPB, BNP, Natriuretic peptides B, Natriuretic peptide B, Natriuretic protein, Brain type natriuretic peptide

Gen-ID: 4879

UniProt: P16860

Pathways: Hormone Activity