HECTD3 Antikörper
-
- Target Alle HECTD3 Antikörper anzeigen
- HECTD3 (HECT Domain Containing 3 (HECTD3))
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HECTD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Flow Cytometry (FACS)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Sequenz
- HYASAKVCEE KLRYAAYNCV AIDTDMSPWE E
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for HECTD3 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human HECTD3(HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).
- Isotyp
- IgG
- Top Product
- Discover our top product HECTD3 Primärantikörper
-
-
- Applikationshinweise
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Kommentare
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HECTD3 (HECT Domain Containing 3 (HECTD3))
- Andere Bezeichnung
- HECTD3 (HECTD3 Produkte)
- Synonyme
- 1700064K09Rik antikoerper, AI467540 antikoerper, AW743312 antikoerper, RP11-69J16.1 antikoerper, E3 ubiquitin-protein ligase HECTD3-like antikoerper, HECT domain E3 ubiquitin protein ligase 3 antikoerper, LOC100222219 antikoerper, HECTD3 antikoerper, Hectd3 antikoerper
- Hintergrund
-
Synonyms: E3 ubiquitin-protein ligase HECTD3, HECT domain-containing protein 3, HECT-type E3 ubiquitin transferase HECTD3, HECTD3
Background: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.
- Gen-ID
- 79654
- UniProt
- Q5T447
-