NFIA Antikörper (Middle Region)

Produktnummer ABIN6719349

Produktdetails anti-NFIA Antikörper

Target: NFIA (Nuclear Factor I/A (NFIA))

Bindungsspezifität: AA 180-224, Middle Region

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser NFIA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Verwendungszweck: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Sequenz: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Klon: 16H11

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Andere Bezeichnung: NFIA (NFIA Produkte)

Synonyme: NFIA antikoerper, CTF antikoerper, NF-I/A antikoerper, NF1-A antikoerper, NFI-A antikoerper, NFI-L antikoerper, si:ch211-88d2.2 antikoerper, wu:fq27e07 antikoerper, zgc:158351 antikoerper, CNFI-A antikoerper, cNFI-A3 antikoerper, 1110047K16Rik antikoerper, 9430022M17Rik antikoerper, NF1A antikoerper, nuclear factor I A antikoerper, nuclear factor I/A antikoerper, NFIA antikoerper, nfia antikoerper, Nfia antikoerper

Hintergrund:

Synonyms: Nuclear factor 1 A-type, NF1-A, Nuclear factor 1/A, CCAAT-box-binding transcription factor, CTF, Nuclear factor I/A, NF-I/A, NFI-A, TGGCA-binding protein, NFIA, KIAA1439

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Gen-ID: 4774

UniProt: Q12857