EWSR1 Antikörper (Middle Region)
-
- Target Alle EWSR1 Antikörper anzeigen
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Bindungsspezifität
- AA 369-399, Middle Region
-
Reaktivität
- Human, Maus, Affe
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser EWSR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.
- Sequenz
- NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Mouse IgG monoclonal antibody for EWSR1 detection. Tested with WB, IHC-P in Human,Mouse,Monkey.
- Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
- Klon
- 4B4
- Isotyp
- IgG
- Top Product
- Discover our top product EWSR1 Primärantikörper
-
-
- Applikationshinweise
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL
- Kommentare
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Andere Bezeichnung
- EWSR1 (EWSR1 Produkte)
- Synonyme
- EWS antikoerper, bK984G1.4 antikoerper, AU018891 antikoerper, Ews antikoerper, Ewsh antikoerper, EWSR1 antikoerper, fc04c01 antikoerper, wu:fc04c01 antikoerper, DKFZp459K1116 antikoerper, ewsr1 antikoerper, ewsr1.S antikoerper, fb40b11 antikoerper, fusl antikoerper, wu:fb40b11 antikoerper, wu:fb75g09 antikoerper, zgc:55864 antikoerper, EWS RNA binding protein 1 antikoerper, Ewing sarcoma breakpoint region 1 antikoerper, EWS RNA-binding protein 1 antikoerper, EWS RNA-binding protein 1a antikoerper, EWS RNA binding protein 1 L homeolog antikoerper, EWS RNA-binding protein 1b antikoerper, EWSR1 antikoerper, Ewsr1 antikoerper, ewsr1a antikoerper, ewsr1 antikoerper, ewsr1.L antikoerper, ewsr1b antikoerper
- Hintergrund
-
Synonyms: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1, EWS
Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
- Gen-ID
- 2130
- UniProt
- Q01844
-