Sucrase Isomaltase Antikörper

Produktnummer ABIN6654192

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Sucrase Isomaltase in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für Sucrase Isomaltase Antikörper (ABIN6654192)

Target: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sucrase Isomaltase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Sucrase Isomaltase Antikörper

Verwendungszweck: Sucrase Isomaltase Antibody / SI

Sequenz: FQLSRWNYKS LDVVKEVVRR NREAGIPFDT QVTDID

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Sucrase Isomaltase

Target: Sucrase Isomaltase (SI) (Sucrase-Isomaltase (Alpha-Glucosidase) (SI))

Andere Bezeichnung: Sucrase Isomaltase

Hintergrund: This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

UniProt: P14410