ZPLD1 Antikörper (C-Term)

Produktnummer ABIN636115

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ZPLD1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für ZPLD1 Antikörper (C-Term) (ABIN636115)

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZPLD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZPLD1 Antikörper

Bindungsspezifität: C-Term

Spezifität: ZPLD1 antibody was raised against the C terminal of ZPLD1

Aufreinigung: Affinity purified

Immunogen: ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZPLD1 Blocking Peptide, (ABIN937237), is also available for use as a blocking control in assays to test for specificity of this ZPLD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZPLD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZPLD1

Target: ZPLD1 (Zona Pellucida-Like Domain Containing 1 (ZPLD1))

Andere Bezeichnung: ZPLD1

Hintergrund: The function of ZPLD1 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 47 kDa (MW of target protein)